CAS Number: 183449-57-2Molecular Weight: 4309.94Salt Form: TFAPurity: >95%Sequence (3-letter): Glp-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OHSequence (1-letter): (Glp)FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 °C or belowAlternate Name: (Pyr3)-Amyloid β-Protein (3-42)
Beta Amyloid [Glp3] (3-42) is a major component of of β-amyloid protein found in the brains of patients with Alzheimer′s disease and Down′s syndrome. It is suggested to accumulate in the brain and trigger beta amyloid plaque deposits.
| Categories | Peptides | 
|---|
| Filter | Alzheimer's, Central Nervous System | 
|---|