CAS Number: 130357-25-4Molecular Weight: 4200.03Salt Form: TFAPurity: >96%Sequence (3-letter): His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2Sequence (1-letter): HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2Storage: -20 °C or below
Exendin-3 is a member of the glucagon family that has secretin-like biological activity when binding to the exendin receptor.
Publications

Powered by Bioz See more details on Bioz
| Categories | Peptides |
|---|
| Filter | Metabolic / Diabetes, Neuropeptides & Hormones |
|---|